PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000875.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 300aa    MW: 34708.2 Da    PI: 7.162
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000875.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.7e-52211451128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              +ppGfrFhPtdeelvv+yL++k++++++++  +i+e+d+yk++Pw+Lp ++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkat
  Itr_sc000875.1_g00001.1  21 MPPGFRFHPTDEELVVHYLCRKCASQSISV-PIIAEIDLYKFDPWQLPDMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKAT 105
                              79****************************.88***************6666689******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk+v +   ++ g+kk Lvfy g+apkg+kt+W+mheyrl
  Itr_sc000875.1_g00001.1 106 GADKPVGK--PKTLGIKKALVFYAGKAPKGVKTNWIMHEYRL 145
                              ******98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.68E-6314171IPR003441NAC domain
PROSITE profilePS5100559.87321171IPR003441NAC domain
PfamPF023651.1E-2722145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKNNGGILNN NEQQQQQQLE MPPGFRFHPT DEELVVHYLC RKCASQSISV PIIAEIDLYK  60
FDPWQLPDMA LYGEKEWYFF SPRDRKYPNG SRPNRAAGTG YWKATGADKP VGKPKTLGIK  120
KALVFYAGKA PKGVKTNWIM HEYRLANVDR SAGKKNNLRL DDWVLCRIYN KKGTVEKYYN  180
AVDQNDVVLP KMEDQKPNIT QFSQSATMLK QAALPPMVQN QHDYMHFDTS ESVLRWHTDS  240
SCCSEQVLSS PEFAADKEVQ SAPKWDDLDF QLNNFIDDPF QVPQYNDPFQ DMFTYMHKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-85101774174Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ2803870.0GQ280387.1 Ipomoea batatas cultivar Tainong 57 NAC1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099683.11e-147PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-124NAC2_ARATH; NAC domain-containing protein 2
TrEMBLC7ENF90.0C7ENF9_IPOBA; NAC1
STRINGPOPTR_0007s04780.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-123NAC family protein